Protein:CAPN3 |
Protein Summary |
Gene summary |
| Gene name: CAPN3 | ASpdb.0 ID: 825 | Gene | Gene symbol | CAPN3 | Gene ID | 825 |
| Gene name | calpain 3 |
| Synonyms | CANP3|CANPL3|LGMD2|LGMD2A|LGMDD4|LGMDR1|nCL-1|p94 |
| Cytomap | 15q15.1 |
| Type of gene | protein-coding |
| Description | calpain-3calpain p94, large [catalytic] subunitcalpain, large polypeptide L3muscle-specific calcium-activated neutral protease 3 large subunitnew calpain 1 |
| Modification date | 20240407 |
| UniProtAcc | P20807 |
Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | CAPN3 | GO:0003824 | catalytic activity | 9642272 |
| Gene | CAPN3 | GO:0005634 | nucleus | 19386580 |
| Gene | CAPN3 | GO:0005730 | nucleolus | 27657329 |
| Gene | CAPN3 | GO:0005737 | cytoplasm | 19386580|19556129 |
| Gene | CAPN3 | GO:0006508 | proteolysis | 9642272|18310072|19386580|20694146 |
| Gene | CAPN3 | GO:0008233 | peptidase activity | 9642272|23707407 |
| Gene | CAPN3 | GO:0030163 | protein catabolic process | 27657329 |
| Gene | CAPN3 | GO:0033234 | negative regulation of protein sumoylation | 20694146 |
| Gene | CAPN3 | GO:0050790 | regulation of catalytic activity | 20694146 |
| Gene | CAPN3 | GO:0055103 | ligase regulator activity | 20694146 |
| Gene | CAPN3 | GO:0097264 | self proteolysis | 9642272 |
| Gene | CAPN3 | GO:1990092 | calcium-dependent self proteolysis | 12482600 |
AS Summary |
Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| P20807-1 | P20807-1_6bjd_A.pdb | 6BJD | X-ray | 2.8 | A | 53 | 417 |
ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| P20807 | CAPN3 | P20807-1 | P20807-2 | 821 | 729 | 268 | 315 | Deletion | none | none | 267 | 267 |
| P20807 | CAPN3 | P20807-1 | P20807-2 | 821 | 729 | 595 | 638 | Deletion | none | none | 546 | 546 |
| P20807 | CAPN3 | P20807-1 | P20807-3 | 821 | 815 | 595 | 600 | Deletion | none | none | 594 | 594 |
| P20807 | CAPN3 | P20807-1 | P20807-4 | 821 | 309 | 1 | 512 | Deletion | none | none | 0 | 0 |
| P20807 | CAPN3 | P20807-1 | P20807-5 | 821 | 156 | 1 | 665 | Deletion | none | none | 0 | 0 |
Multiple sequence alignment of our canonical and alternatively spliced CAPN3 |
Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of CAPN3 |
| UniProt-id | ENSG | ENST | ENSP |
| P20807-1 | ENSG00000092529.26 | ENST00000397163.8 | ENSP00000380349.3 |
| P20807-2 | ENSG00000092529.26 | ENST00000349748.8 | ENSP00000183936.4 |
| P20807-3 | ENSG00000092529.26 | ENST00000357568.8 | ENSP00000350181.3 |
| P20807-4 | ENSG00000092529.26 | ENST00000397200.8 | ENSP00000380384.4 |
| P20807-5 | ENSG00000092529.26 | ENST00000337571.9 | ENSP00000336840.4 |
| P20807-5 | ENSG00000092529.26 | ENST00000397204.9 | ENSP00000380387.4 |
| P20807-5 | ENSG00000092529.26 | ENST00000569136.6 | ENSP00000455254.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000673692.1 | ENSP00000501138.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000673771.1 | ENSP00000501023.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000673851.1 | ENSP00000501142.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000673886.1 | ENSP00000501155.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000673890.1 | ENSP00000501293.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000673928.1 | ENSP00000501099.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000673936.1 | ENSP00000501189.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000674018.1 | ENSP00000501271.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000674093.1 | ENSP00000501303.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000674119.1 | ENSP00000501217.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000674139.1 | ENSP00000501054.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000674146.1 | ENSP00000501175.1 |
| P20807-5 | ENSG00000092529.26 | ENST00000674149.1 | ENSP00000501112.1 |
| UniProt-id | NM ID | NP ID |
| P20807-1 | NM_000070.2 | NP_000061.1 |
| P20807-2 | NM_173087.1 | NP_775110.1 |
| P20807-3 | NM_024344.1 | NP_077320.1 |
| P20807-4 | NM_173088.1 | NP_775111.1 |
| P20807-5 | NM_173089.1 | NP_775112.1 |
| P20807-5 | NM_173090.1 | NP_775113.1 |
Amino acid sequences of our canonical and alternatively spliced CAPN3 |
| accession_id | Protein sequence |
| P20807-1 | MPTVISASVAPRTAAEPRSPGPVPHPAQSKATEAGGGNPSGIYSAIISRNFPIIGVKEKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYS QKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDD CLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEIRDAPSDMYKIMKKAIERGSLMGCSIDDGT NMTYGTSPSGLNMGELIARMVRNMDNSLLQDSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPW GQVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKLQTWTVSVNEGRWVRGCSAGGCRNF PDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINM REVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSP DKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHL WNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLN |
| P20807-2 | MPTVISASVAPRTAAEPRSPGPVPHPAQSKATEAGGGNPSGIYSAIISRNFPIIGVKEKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYS QKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDD CLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEIRDAPSDMYKIMKKAIERGSLMGCSIDTII PVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPWGQVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHF TKLEICNLTADALQSDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGAS LFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTI SVDRPVPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWN KIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVL |
| P20807-3 | MPTVISASVAPRTAAEPRSPGPVPHPAQSKATEAGGGNPSGIYSAIISRNFPIIGVKEKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYS QKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDD CLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEIRDAPSDMYKIMKKAIERGSLMGCSIDDGT NMTYGTSPSGLNMGELIARMVRNMDNSLLQDSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPW GQVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSDKLQTWTVSVNEGRWVRGCSAGGCRNF PDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINM REVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQS PQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKA WQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQ |
| P20807-4 | MHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPI IFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKTHGF TLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSF |
| P20807-5 | MEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAG |
Protein Functional Features |
Main function of this protein. (from UniProt) |
| CAPN3 (go to UniProt):P20807 |
Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| P20807 | Domain | 74 | 417 | Note=Calpain catalytic;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00239 | Type=Deletion;Start=268;End=315 |
| P20807 | Domain | 74 | 417 | Note=Calpain catalytic;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00239 | Type=Deletion;Start=1;End=512 |
| P20807 | Domain | 74 | 417 | Note=Calpain catalytic;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00239 | Type=Deletion;Start=1;End=665 |
| P20807 | Domain | 649 | 683 | Note=EF-hand 1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00448 | Type=Deletion;Start=1;End=665 |
| P20807 | Region | 7 | 37 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=512 |
| P20807 | Region | 7 | 37 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=665 |
| P20807 | Region | 418 | 586 | Note=Domain III | Type=Deletion;Start=1;End=512 |
| P20807 | Region | 418 | 586 | Note=Domain III | Type=Deletion;Start=1;End=665 |
| P20807 | Region | 587 | 649 | Note=Linker | Type=Deletion;Start=595;End=638 |
| P20807 | Region | 587 | 649 | Note=Linker | Type=Deletion;Start=595;End=600 |
| P20807 | Region | 587 | 649 | Note=Linker | Type=Deletion;Start=1;End=665 |
| P20807 | Region | 609 | 652 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=595;End=638 |
| P20807 | Region | 609 | 652 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=665 |
| P20807 | Region | 650 | 821 | Note=Domain IV | Type=Deletion;Start=1;End=665 |
| P20807 | Compositional bias | 613 | 630 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=595;End=638 |
| P20807 | Compositional bias | 613 | 630 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=665 |
| P20807 | Compositional bias | 631 | 652 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=595;End=638 |
| P20807 | Compositional bias | 631 | 652 | Note=Polar residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=665 |
Gene Isoform Structures and Expression Levels for CAPN3 |
Gene structures of our canonical and alternative spliced genes of CAPN3* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Expression levels of gene isoforms across GTEx. |
Expression levels of gene isoforms across TCGA. |
Protein Structures |
PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of P20807-1 |
| 3D view using mol* of P20807-2 |
| 3D view using mol* of P20807-3 |
| 3D view using mol* of P20807-4 |
| 3D view using mol* of P20807-5 |
pLDDT Score Distribution |
pLDDT score distribution of the predicted protein structures from AlphaFold2* AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
Ramachandran Plot of Protein Structures |
Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of P20807-1 |
![]() |
| Ramachandran plot of P20807-2 |
![]() |
| Ramachandran plot of P20807-3 |
![]() |
| Ramachandran plot of P20807-5 |
![]() |
Potential Active Site Information |
The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| P20807-1 | 1.112 | 215 | 1.174 | 430.122 | 0.457 | 0.765 | 1.022 | 1.88 | 0.691 | 2.719 | 0.704 | 588,589,590,602,603,604,605,702,703,704,705,706,70 8,758,762,765,766,769,770,785,788,789,791,792,793, 794,795,796,797,807,812,814,815,816,817,818,819,82 0,821 |
| P20807-2 | 1.044 | 220 | 1.025 | 570.409 | 0.455 | 0.763 | 1.015 | 0.635 | 1.143 | 0.555 | 0.695 | 127,129,130,221,222,223,224,236,237,238,239,240,24 3,245,247,251,265,266,267,268,274,275,285,286,287, 362,364,373,374,433,486,487,488,490,492,495,496,49 7,498 |
| P20807-3 | 1.092 | 133 | 1.116 | 271.656 | 0.39 | 0.809 | 1.116 | 1.052 | 0.95 | 1.107 | 1.19 | 596,597,598,599,600,602,696,697,698,699,700,702,78 2,785,786,788,789,793,807,810,811,814,815 |
| P20807-4 | 1.03 | 184 | 1.058 | 606.767 | 0.429 | 0.72 | 0.953 | 0.864 | 0.962 | 0.898 | 0.53 | 1,3,4,5,7,8,12,13,37,41,42,43,44,45,57,58,59,61,67 ,68,69,70,71,72,73,74,247,248,249 |
| P20807-5 | 0.941 | 46 | 1.006 | 142.345 | 0.57 | 0.718 | 0.937 | 2.867 | 0.191 | 15.023 | 0.613 | 93,97,100,101,104,105,120,123,124,127,128,131
|
Protein Structure and Feature Comparision |
Protein Structure Comparision Using Template Modeling Scores (TM-score). |
![]() |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of P20807-1_P20807-1_6bjd_A.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P20807-1_6bjd_A_P20807-2.pdb |
| 3D view using mol* of P20807-1_6bjd_A_P20807-3.pdb |
| 3D view using mol* of P20807-1_6bjd_A_P20807-4.pdb |
| 3D view using mol* of P20807-1_6bjd_A_P20807-5.pdb |
Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of P20807-1_P20807-2.pdb |
| 3D view using mol* of P20807-1_P20807-3.pdb |
| 3D view using mol* of P20807-1_P20807-4.pdb |
| 3D view using mol* of P20807-1_P20807-5.pdb |
Protein Feature Comparison of the protein sequendary structures among the protiens. |
Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/P20807-1_vs_P20807-2.png |
< |
| ./stats/relative_asa/P20807-1_vs_P20807-3.png |
< |
| ./stats/relative_asa/P20807-1_vs_P20807-4.png |
< |
| ./stats/relative_asa/P20807-1_vs_P20807-5.png |
< |
Protein-Protein Interaction |
Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to CAPN3 |
Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
| P20807 | CAPN3 | DB06124 | L-aminocarnityl-succinyl-leucyl-argininal-diethylacetal | investigational |
Related Diseases to CAPN3 |
Previous studies relating to the alternative splicing of CAPN3 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| CAPN3 | 22158424 | CAPN3 mRNA processing alteration caused by splicing mutation associated with novel genomic rearrangement of Alu elements. | Recessive mutations of CAPN3 gene are reported to be responsible for limb girdle muscular dystrophy type 2A (LGMD2A). In all, 15-25% of intronic nucleotide changes identified in this gene were investigated by in silico analysis, but occasionally supported by experimental data or reported in some cases as a polymorphism. We report here genetic and transcriptional analyses in three Tunisian patients belonging to the same consanguineous family sharing the same mutation c.1194-9 A>G and Alu repeats insertion in intron 7 of CAPN3 gene. Reverse transcriptase-PCR experiments performed on total RNA from the patient's muscle biopsy showed retention of the eight last nucleotides of intron 9 in the CAPN3 transcript lacking the first seven exons. Our results provide evidence regarding the potential involvement of Alu elements in aberrant processing of pre-mRNA owing to the disruption of pre-existing intronic splicing regulatory elements. We also demonstrated variable mRNA alternative splicing among tissues and between LGMD2A patients. A deep intronic variation and rearrangement have been reported in the literature as causing genetic diseases in humans. However, this is the first report on a potential pathogenic CAPN3 gene mutation resulting from an Alu insertion. | D049288 | Muscular Dystrophies, Limb-Girdle |
Clinically important variants in CAPN3 |
(ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
| P20807 | P20807-1 | CAPN3 | Deletion | p.Ser215_Gly221del | Pathogenic |
| P20807 | P20807-1 | CAPN3 | Deletion | p.Ser215_Gly221del | Pathogenic |
|
|