Protein:RASSF5 |
Protein Summary |
 Gene summary |
| Gene name: RASSF5 | ASpdb.0 ID: 83593 | Gene | Gene symbol | RASSF5 | Gene ID | 83593 |
| Gene name | Ras association domain family member 5 |
| Synonyms | Maxp1|NORE1|NORE1A|NORE1B|RAPL|RASSF3 |
| Cytomap | 1q32.1 |
| Type of gene | protein-coding |
| Description | ras association domain-containing protein 5Rap1-binding proteinRas association (RalGDS/AF-6) domain family 5Ras association (RalGDS/AF-6) domain family member 5Ras effector-like proteinnew ras effector 1novel Ras effector 1regulator for cell adhesi |
| Modification date | 20240305 |
| UniProtAcc | Q8WWW0 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q8WWW0-1 | Q8WWW0-1_4lgd_G.pdb | 4LGD | X-ray | 3.05 | G | 366 | 413 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q8WWW0 | RASSF5 | Q8WWW0-1 | Q8WWW0-2 | 418 | 265 | 1 | 153 | Deletion | none | none | 0 | 0 |
| Q8WWW0 | RASSF5 | Q8WWW0-1 | Q8WWW0-2 | 418 | 265 | 154 | 193 | Substitution | CKFTCHPECRSLIQLDCSQQEGLSRDRPSPESTLTVTFSQ | MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSK | 1 | 40 |
| Q8WWW0 | RASSF5 | Q8WWW0-1 | Q8WWW0-3 | 418 | 336 | 331 | 336 | Substitution | LFQKLS | GCLLHP | 331 | 336 |
| Q8WWW0 | RASSF5 | Q8WWW0-1 | Q8WWW0-3 | 418 | 336 | 337 | 418 | Deletion | none | none | 336 | 336 |
| Multiple sequence alignment of our canonical and alternatively spliced RASSF5 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of RASSF5 |
| UniProt-id | ENSG | ENST | ENSP |
| Q8WWW0-1 | ENSG00000266094.8 | ENST00000579436.7 | ENSP00000462099.1 |
| Q8WWW0-2 | ENSG00000266094.8 | ENST00000577571.5 | ENSP00000462576.1 |
| Q8WWW0-3 | ENSG00000266094.8 | ENST00000580449.5 | ENSP00000462544.1 |
| UniProt-id | NM ID | NP ID |
| Q8WWW0-1 | NM_182663.3 | NP_872604.1 |
| Q8WWW0-2 | NM_182665.3 | NP_872606.1 |
| Q8WWW0-3 | NM_182664.3 | NP_872605.1 |
| Amino acid sequences of our canonical and alternatively spliced RASSF5 |
| accession_id | Protein sequence |
| Q8WWW0-1 | MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGRSARRAARGNLEPPPRASRPARPLRPGLQQR LRRRPGAPRPRDVRSIFEQPQDPRVPAERGEGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDR PSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNL AATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK |
| Q8WWW0-2 | MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVH LKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQ |
| Q8WWW0-3 | MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGRSARRAARGNLEPPPRASRPARPLRPGLQQR LRRRPGAPRPRDVRSIFEQPQDPRVPAERGEGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDR PSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNL |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| RASSF5 (go to UniProt):Q8WWW0 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q8WWW0 | Domain | 274 | 364 | Note=Ras-associating;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00166 | Type=Substitution;Start=331;End=336 |
| Q8WWW0 | Domain | 274 | 364 | Note=Ras-associating;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00166 | Type=Deletion;Start=337;End=418 |
| Q8WWW0 | Domain | 366 | 413 | Note=SARAH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00310 | Type=Deletion;Start=337;End=418 |
| Q8WWW0 | Zinc finger | 122 | 170 | Note=Phorbol-ester/DAG-type;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00226 | Type=Deletion;Start=1;End=153 |
| Q8WWW0 | Zinc finger | 122 | 170 | Note=Phorbol-ester/DAG-type;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00226 | Type=Substitution;Start=154;End=193 |
| Q8WWW0 | Region | 1 | 118 | Note=Disordered;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=153 |
| Q8WWW0 | Compositional bias | 28 | 43 | Note=Pro residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=153 |
| Q8WWW0 | Compositional bias | 95 | 118 | Note=Basic and acidic residues;Ontology_term=ECO:0000256;evidence=ECO:0000256|SAM:MobiDB-lite | Type=Deletion;Start=1;End=153 |
Gene Isoform Structures and Expression Levels for RASSF5 |
| Gene structures of our canonical and alternative spliced genes of RASSF5 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q8WWW0-1 |
| 3D view using mol* of Q8WWW0-2 |
| 3D view using mol* of Q8WWW0-3 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q8WWW0-1 |
 |
| pLDDT distribution across the protein length of Q8WWW0-2 |
 |
| pLDDT distribution across the protein length of Q8WWW0-3 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q8WWW0-1 |
 |
| Ramachandran plot of Q8WWW0-2 |
 |
| Ramachandran plot of Q8WWW0-3 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q8WWW0-1 | 0.994 | 232 | 1.032 | 947.709 | 0.663 | 0.657 | 0.791 | 0.381 | 0.927 | 0.411 | 0.63 | 188,189,190,191,192,193,194,195,196,197,198,199,20 1,203,205,206,211,236,245,247,248,284,285,294,295, 321,322,324,326,329,330,331,332,333,334,335,336,33 8,339,340,343,344,347,348,354,355,360,361,362,363, 364,366 |
| Q8WWW0-2 | 0.977 | 167 | 1.018 | 446.586 | 0.649 | 0.627 | 0.852 | 0.407 | 0.915 | 0.445 | 1.506 | 95,96,97,98,106,114,115,116,117,118,119,145,146,14 9,150,153,154,157,158,159,160,162,163,164,165,166, 167,181,182,184,208,209,211,212,213,214,215 |
| Q8WWW0-3 | 1.044 | 749 | 1.084 | 2192.456 | 0.566 | 0.716 | 0.925 | 0.938 | 0.876 | 1.07 | 0.889 | 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,11 0,111,112,113,115,116,117,118,136,139,150,153,154, 155,166,167,168,169,170,171,172,173,174,187,189,19 0,191,192,193,194,195,196,197,198,203,204,205,206, 210,211,214,215,218,226,228,235,236,237,238,239,24 0,241,242,243,244,245,246,247,248,249,250,278,279, 280,281,282,284,285,286,289,292,293,294,295,297,29 8,299,301,302,303,305,306,309,311,315,316,317,318, 319,320,321,322,323,324,326,329,330,331,332,333,33 4,335,336 |
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q8WWW0-1_Q8WWW0-1_4lgd_G.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q8WWW0-1_4lgd_G_Q8WWW0-2.pdb |
| 3D view using mol* of Q8WWW0-1_4lgd_G_Q8WWW0-3.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q8WWW0-1_Q8WWW0-2.pdb |
| 3D view using mol* of Q8WWW0-1_Q8WWW0-3.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q8WWW0-1_vs_Q8WWW0-2.png |
 < |
| ./stats/secondary_structure/figure/Q8WWW0-1_vs_Q8WWW0-3.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q8WWW0-1_vs_Q8WWW0-2.png |
 < |
| ./stats/relative_asa/Q8WWW0-1_vs_Q8WWW0-3.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to RASSF5 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to RASSF5 |
| Previous studies relating to the alternative splicing of RASSF5 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| RASSF5 | 25420558 | Decreased expression and aberrant methylation of RASSF5A correlates with malignant progression of gastric cardia adenocarcinoma. | Due to alternative splicing and differential promoter usage, RASSF5 exists in at least three isoforms, RASSF5A, RASSF5B, and RASSF5C. Expression and epigenetic inactivation of different transcripts of RASSF5 in gastric cardia adenocarcinoma (GCA) progression have not been evaluated. Quantitative real-time RT-PCR and immunohistochemistry (IHC) methods were used respectively to detect the role of RASSF5A, RASSF5B, and RASSF5C in 132 GCA cases and BS-MSP method was used to clarify the critical CpG sites of RASSF5A. Expression of RASSF5A and RASSF5C transcripts were easily detectable in all normal gastric cardia epithelial tissues; however, expression of RASSF5B was rare detected in normal gastric cardia epithelial tissues and tumor tissues. Both RASSF5A and RASSF5C expression were frequently downregulated in GCA tumor tissues and RASSF5A was more commonly down-regulated compared to RASSF5C. Abnormal reduction of RASSF5A was more commonly observed in advanced stage and poor differentiated tumors. The methylation frequency of CpG island 1 region of RASSF5A in GCA tumor tissues was significantly higher than that in corresponding normal tissues and was inversely correlated with RASSF5A expression. Aberrant promoter methylation of RASSF5C was not found in GCA. RASSF5A methylation and protein expression were independently associated with GCA patients' survival. These results indicate that down-regulation of RASSF5A and RASSF5C expression is a tumor-specific phenomenon and RASSF5A may be a more common target for inactivation in GCA. Inactivation of RASSF5A through CpG island 1 methylation may play an important role in GCA carcinogenesis and may serve as a prognostic biomarker for GCA. | D000230 | Adenocarcinoma |
| RASSF5 | 25420558 | Decreased expression and aberrant methylation of RASSF5A correlates with malignant progression of gastric cardia adenocarcinoma. | Due to alternative splicing and differential promoter usage, RASSF5 exists in at least three isoforms, RASSF5A, RASSF5B, and RASSF5C. Expression and epigenetic inactivation of different transcripts of RASSF5 in gastric cardia adenocarcinoma (GCA) progression have not been evaluated. Quantitative real-time RT-PCR and immunohistochemistry (IHC) methods were used respectively to detect the role of RASSF5A, RASSF5B, and RASSF5C in 132 GCA cases and BS-MSP method was used to clarify the critical CpG sites of RASSF5A. Expression of RASSF5A and RASSF5C transcripts were easily detectable in all normal gastric cardia epithelial tissues; however, expression of RASSF5B was rare detected in normal gastric cardia epithelial tissues and tumor tissues. Both RASSF5A and RASSF5C expression were frequently downregulated in GCA tumor tissues and RASSF5A was more commonly down-regulated compared to RASSF5C. Abnormal reduction of RASSF5A was more commonly observed in advanced stage and poor differentiated tumors. The methylation frequency of CpG island 1 region of RASSF5A in GCA tumor tissues was significantly higher than that in corresponding normal tissues and was inversely correlated with RASSF5A expression. Aberrant promoter methylation of RASSF5C was not found in GCA. RASSF5A methylation and protein expression were independently associated with GCA patients' survival. These results indicate that down-regulation of RASSF5A and RASSF5C expression is a tumor-specific phenomenon and RASSF5A may be a more common target for inactivation in GCA. Inactivation of RASSF5A through CpG island 1 methylation may play an important role in GCA carcinogenesis and may serve as a prognostic biomarker for GCA. | D018450 | Disease Progression |
| RASSF5 | 25420558 | Decreased expression and aberrant methylation of RASSF5A correlates with malignant progression of gastric cardia adenocarcinoma. | Due to alternative splicing and differential promoter usage, RASSF5 exists in at least three isoforms, RASSF5A, RASSF5B, and RASSF5C. Expression and epigenetic inactivation of different transcripts of RASSF5 in gastric cardia adenocarcinoma (GCA) progression have not been evaluated. Quantitative real-time RT-PCR and immunohistochemistry (IHC) methods were used respectively to detect the role of RASSF5A, RASSF5B, and RASSF5C in 132 GCA cases and BS-MSP method was used to clarify the critical CpG sites of RASSF5A. Expression of RASSF5A and RASSF5C transcripts were easily detectable in all normal gastric cardia epithelial tissues; however, expression of RASSF5B was rare detected in normal gastric cardia epithelial tissues and tumor tissues. Both RASSF5A and RASSF5C expression were frequently downregulated in GCA tumor tissues and RASSF5A was more commonly down-regulated compared to RASSF5C. Abnormal reduction of RASSF5A was more commonly observed in advanced stage and poor differentiated tumors. The methylation frequency of CpG island 1 region of RASSF5A in GCA tumor tissues was significantly higher than that in corresponding normal tissues and was inversely correlated with RASSF5A expression. Aberrant promoter methylation of RASSF5C was not found in GCA. RASSF5A methylation and protein expression were independently associated with GCA patients' survival. These results indicate that down-regulation of RASSF5A and RASSF5C expression is a tumor-specific phenomenon and RASSF5A may be a more common target for inactivation in GCA. Inactivation of RASSF5A through CpG island 1 methylation may play an important role in GCA carcinogenesis and may serve as a prognostic biomarker for GCA. | D020022 | Genetic Predisposition to Disease |
| RASSF5 | 25420558 | Decreased expression and aberrant methylation of RASSF5A correlates with malignant progression of gastric cardia adenocarcinoma. | Due to alternative splicing and differential promoter usage, RASSF5 exists in at least three isoforms, RASSF5A, RASSF5B, and RASSF5C. Expression and epigenetic inactivation of different transcripts of RASSF5 in gastric cardia adenocarcinoma (GCA) progression have not been evaluated. Quantitative real-time RT-PCR and immunohistochemistry (IHC) methods were used respectively to detect the role of RASSF5A, RASSF5B, and RASSF5C in 132 GCA cases and BS-MSP method was used to clarify the critical CpG sites of RASSF5A. Expression of RASSF5A and RASSF5C transcripts were easily detectable in all normal gastric cardia epithelial tissues; however, expression of RASSF5B was rare detected in normal gastric cardia epithelial tissues and tumor tissues. Both RASSF5A and RASSF5C expression were frequently downregulated in GCA tumor tissues and RASSF5A was more commonly down-regulated compared to RASSF5C. Abnormal reduction of RASSF5A was more commonly observed in advanced stage and poor differentiated tumors. The methylation frequency of CpG island 1 region of RASSF5A in GCA tumor tissues was significantly higher than that in corresponding normal tissues and was inversely correlated with RASSF5A expression. Aberrant promoter methylation of RASSF5C was not found in GCA. RASSF5A methylation and protein expression were independently associated with GCA patients' survival. These results indicate that down-regulation of RASSF5A and RASSF5C expression is a tumor-specific phenomenon and RASSF5A may be a more common target for inactivation in GCA. Inactivation of RASSF5A through CpG island 1 methylation may play an important role in GCA carcinogenesis and may serve as a prognostic biomarker for GCA. | D013274 | Stomach Neoplasms |
Clinically important variants in RASSF5 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |