Protein:ING5 |
Protein Summary |
 Gene summary |
| Gene name: ING5 | ASpdb.0 ID: 84289 | Gene | Gene symbol | ING5 | Gene ID | 84289 |
| Gene name | inhibitor of growth family member 5 |
| Synonyms | p28ING5 |
| Cytomap | 2q37.3 |
| Type of gene | protein-coding |
| Description | inhibitor of growth protein 5 |
| Modification date | 20240403 |
| UniProtAcc | Q8WYH8 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | ING5 | GO:0000123 | histone acetyltransferase complex | 16387653|24065767 |
| Gene | ING5 | GO:0001558 | regulation of cell growth | 22144582 |
| Gene | ING5 | GO:0005634 | nucleus | 18794358|24065767 |
| Gene | ING5 | GO:0005654 | nucleoplasm | 16387653 |
| Gene | ING5 | GO:0006275 | regulation of DNA replication | 16387653 |
| Gene | ING5 | GO:0006355 | regulation of DNA-templated transcription | 18794358|22144582 |
| Gene | ING5 | GO:0006473 | protein acetylation | 12750254 |
| Gene | ING5 | GO:0008285 | negative regulation of cell population proliferation | 12750254 |
| Gene | ING5 | GO:0035064 | methylated histone binding | 16728974 |
| Gene | ING5 | GO:0045926 | negative regulation of growth | 12750254 |
| Gene | ING5 | GO:0051726 | regulation of cell cycle | 16387653 |
| Gene | ING5 | GO:0070776 | MOZ/MORF histone acetyltransferase complex | 16387653|18794358 |
| Gene | ING5 | GO:0140889 | DNA replication-dependent chromatin disassembly | 16387653 |
| Gene | ING5 | GO:2000278 | regulation of DNA biosynthetic process | 16387653 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q8WYH8-1 | Q8WYH8-1_5mto_A.pdb | 5MTO | X-ray | 3.1 | A | 1 | 105 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q8WYH8 | ING5 | Q8WYH8-1 | Q8WYH8-2 | 240 | 226 | 227 | 240 | Deletion | none | none | 226 | 226 |
| Multiple sequence alignment of our canonical and alternatively spliced ING5 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of ING5 |
| UniProt-id | ENSG | ENST | ENSP |
| Q8WYH8-1 | ENSG00000168395.16 | ENST00000313552.11 | ENSP00000322142.7 |
| Q8WYH8-2 | ENSG00000168395.16 | ENST00000406941.5 | ENSP00000385937.1 |
| UniProt-id | NM ID | NP ID |
| Q8WYH8-1 | NM_032329.5 | NP_115705.2 |
| Q8WYH8-2 | NM_001330162.1 | NP_001317091.1 |
| Amino acid sequences of our canonical and alternatively spliced ING5 |
| accession_id | Protein sequence |
| Q8WYH8-1 | MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQLAMQTY EMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMP |
| Q8WYH8-2 | MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQLAMQTY EMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMP |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| ING5 (go to UniProt):Q8WYH8 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q8WYH8 | Zinc finger | 186 | 235 | Note=PHD-type;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00146 | Type=Deletion;Start=227;End=240 |
Gene Isoform Structures and Expression Levels for ING5 |
| Gene structures of our canonical and alternative spliced genes of ING5 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q8WYH8-1 |
| 3D view using mol* of Q8WYH8-2 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q8WYH8-1 |
 |
| pLDDT distribution across the protein length of Q8WYH8-2 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q8WYH8-1 |
 |
| Ramachandran plot of Q8WYH8-2 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q8WYH8-1 | 0.88 | 50 | 0.938 | 119.021 | 0.63 | 0.635 | 0.882 | 2.194 | 0.331 | 6.626 | 1.15 | 5,6,7,9,10,100,103,104,106,107
|
| Q8WYH8-2 | 0.838 | 40 | 0.902 | 74.088 | 0.667 | 0.612 | 0.803 | 2.828 | 0.184 | 15.412 | 5.094 | 3,6,7,9,10,100,103,104,107
|
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q8WYH8-1_Q8WYH8-1_5mto_A.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q8WYH8-1_5mto_A_Q8WYH8-2.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q8WYH8-1_Q8WYH8-2.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q8WYH8-1_vs_Q8WYH8-2.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q8WYH8-1_vs_Q8WYH8-2.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to ING5 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to ING5 |
| Previous studies relating to the alternative splicing of ING5 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| ING5 | 20131318 | Tumor-specific mutation and downregulation of ING5 detected in oral squamous cell carcinoma. | Our previous study showed high frequency of allelic loss at chromosome 2q37 region in oral cancer. This location contains several candidate tumor suppressor genes such as PPP1R7, ILKAP, DTYMK and ING5. We previously showed 3 members of inhibitor of growth (ING) family, ING1, ING3 and ING4 as tumor suppressor gene in head and neck cancer. As ING5 shows high homology with other members of ING genes including highly conserved carboxy-terminal plant homeodomain and nuclear localization signal, we first picked up ING5 and examined it as a possible tumor suppressor in oral cancer. For this aim, mutation and mRNA expression status of ING5 in paired normal and oral squamous cell carcinoma samples were examined by reverse transcription polymerase chain reaction (RT-PCR) and sequencing. Three missense mutations located within leucine zipper like (LZL) finger and novel conserved region (NCR) domains in ING5 protein were detected, probably abrogating its normal function. We also found 5 different alternative splicing variants of ING5. Then, we examined mRNA level of ING5 by quantitative real time reverse transcription polymerase chain reaction (qRT-PCR) analysis, which demonstrated decreased expression of ING5 mRNA in 61% of the primary tumors as compared to the matched normal samples. In conclusion, tumor-specific mutation and downregulation of ING5 mRNA suggested it as a tumor suppressor gene in oral squamous cell carcinoma. | D002294 | Carcinoma, Squamous Cell |
| ING5 | 20131318 | Tumor-specific mutation and downregulation of ING5 detected in oral squamous cell carcinoma. | Our previous study showed high frequency of allelic loss at chromosome 2q37 region in oral cancer. This location contains several candidate tumor suppressor genes such as PPP1R7, ILKAP, DTYMK and ING5. We previously showed 3 members of inhibitor of growth (ING) family, ING1, ING3 and ING4 as tumor suppressor gene in head and neck cancer. As ING5 shows high homology with other members of ING genes including highly conserved carboxy-terminal plant homeodomain and nuclear localization signal, we first picked up ING5 and examined it as a possible tumor suppressor in oral cancer. For this aim, mutation and mRNA expression status of ING5 in paired normal and oral squamous cell carcinoma samples were examined by reverse transcription polymerase chain reaction (RT-PCR) and sequencing. Three missense mutations located within leucine zipper like (LZL) finger and novel conserved region (NCR) domains in ING5 protein were detected, probably abrogating its normal function. We also found 5 different alternative splicing variants of ING5. Then, we examined mRNA level of ING5 by quantitative real time reverse transcription polymerase chain reaction (qRT-PCR) analysis, which demonstrated decreased expression of ING5 mRNA in 61% of the primary tumors as compared to the matched normal samples. In conclusion, tumor-specific mutation and downregulation of ING5 mRNA suggested it as a tumor suppressor gene in oral squamous cell carcinoma. | D009062 | Mouth Neoplasms |
Clinically important variants in ING5 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |