Protein:IL1RL1 |
Protein Summary |
 Gene summary |
| Gene name: IL1RL1 | ASpdb.0 ID: 9173 | Gene | Gene symbol | IL1RL1 | Gene ID | 9173 |
| Gene name | interleukin 1 receptor like 1 |
| Synonyms | DER4|FIT-1|IL33R|ST2|ST2L|ST2V|T1 |
| Cytomap | 2q12.1 |
| Type of gene | protein-coding |
| Description | interleukin-1 receptor-like 1growth stimulation-expressedhomolog of mouse growth stimulation-expressedinterleukin 1 receptor-related protein |
| Modification date | 20240411 |
| UniProtAcc | Q01638 |
| Gene ontology of this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Gene | IL1RL1 | GO:0002114 | interleukin-33 receptor activity | 16286016 |
| Gene | IL1RL1 | GO:0005829 | cytosol | - |
| Gene | IL1RL1 | GO:0005886 | plasma membrane | - |
| Gene | IL1RL1 | GO:0005925 | focal adhesion | - |
| Gene | IL1RL1 | GO:0038172 | interleukin-33-mediated signaling pathway | 16286016 |
AS Summary |
| Information of the canonical protein with experimentally identified structure from PDB (2023). |
| UniProt Acc | File name | PDB ID | Method | Resolution | Chain | Start | End |
| Q01638-1 | Q01638-1_4kc3_B.pdb | 4KC3 | X-ray | 3.27 | B | 21 | 317 |
| ASpdb's canonical and alternatively spliced isoform information. |
| accession_id | gene_name | canonical_id | alternative_id | canonical_length | alternative_length | canonical_start | canonical_end | type | originalSEQ | variationSEQ | alternative_start | alternative_end |
| Q01638 | IL1RL1 | Q01638-1 | Q01638-2 | 556 | 328 | 324 | 328 | Substitution | IDHHS | SKECF | 324 | 328 |
| Q01638 | IL1RL1 | Q01638-1 | Q01638-2 | 556 | 328 | 329 | 556 | Deletion | none | none | 328 | 328 |
| Q01638 | IL1RL1 | Q01638-1 | Q01638-3 | 556 | 259 | 204 | 259 | Substitution | DEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKIT | VWCQSFCKLKKSLIFSNTHWIQSLMRGFVMVYYGVHKCCRVVFNLCLQYFQHHQWP | 204 | 259 |
| Q01638 | IL1RL1 | Q01638-1 | Q01638-3 | 556 | 259 | 260 | 556 | Deletion | none | none | 259 | 259 |
| Q01638 | IL1RL1 | Q01638-1 | Q01638-4 | 556 | 211 | 1 | 117 | Deletion | none | none | 0 | 0 |
| Q01638 | IL1RL1 | Q01638-1 | Q01638-4 | 556 | 211 | 324 | 328 | Substitution | IDHHS | SKECF | 207 | 211 |
| Q01638 | IL1RL1 | Q01638-1 | Q01638-4 | 556 | 211 | 329 | 556 | Deletion | none | none | 211 | 211 |
| Multiple sequence alignment of our canonical and alternatively spliced IL1RL1 |
| Matched gene isoform IDs with Ensembl and RefSeq of our canonical and alternative spliced genes of IL1RL1 |
| UniProt-id | ENSG | ENST | ENSP |
| Q01638-1 | ENSG00000115602.17 | ENST00000233954.6 | ENSP00000233954.1 |
| Q01638-2 | ENSG00000115602.17 | ENST00000311734.6 | ENSP00000310371.2 |
| Q01638-3 | ENSG00000115602.17 | ENST00000427077.1 | ENSP00000391120.1 |
| Q01638-4 | ENSG00000115602.17 | ENST00000404917.6 | ENSP00000384822.2 |
| UniProt-id | NM ID | NP ID |
| Q01638-1 | NM_016232.4 | NP_057316.3 |
| Q01638-1 | XM_006712839.3 | XP_006712902.1 |
| Q01638-2 | NM_003856.3 | NP_003847.2 |
| Q01638-2 | XM_011512151.1 | XP_011510453.1 |
| Q01638-4 | NM_001282408.1 | NP_001269337.1 |
| Amino acid sequences of our canonical and alternatively spliced IL1RL1 |
| accession_id | Protein sequence |
| Q01638-1 | MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVR SPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEE GQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLL WRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTP QITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSK |
| Q01638-2 | MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVR SPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEE |
| Q01638-3 | MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVR SPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT |
| Q01638-4 | MYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQG FSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDL |
Protein Functional Features |
| Main function of this protein. (from UniProt) |
| IL1RL1 (go to UniProt):Q01638 |
| Retention analysis result of protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Q01638 | Topological domain | 19 | 328 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=324;End=328 |
| Q01638 | Topological domain | 19 | 328 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=204;End=259 |
| Q01638 | Topological domain | 19 | 328 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=260;End=556 |
| Q01638 | Topological domain | 19 | 328 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=1;End=117 |
| Q01638 | Topological domain | 19 | 328 | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Substitution;Start=324;End=328 |
| Q01638 | Transmembrane | 329 | 349 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=329;End=556 |
| Q01638 | Transmembrane | 329 | 349 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=260;End=556 |
| Q01638 | Transmembrane | 329 | 349 | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=329;End=556 |
| Q01638 | Topological domain | 350 | 556 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=329;End=556 |
| Q01638 | Topological domain | 350 | 556 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=260;End=556 |
| Q01638 | Topological domain | 350 | 556 | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 | Type=Deletion;Start=329;End=556 |
| Q01638 | Domain | 19 | 103 | Note=Ig-like C2-type 1 | Type=Deletion;Start=1;End=117 |
| Q01638 | Domain | 114 | 197 | Note=Ig-like C2-type 2 | Type=Deletion;Start=1;End=117 |
| Q01638 | Domain | 212 | 319 | Note=Ig-like C2-type 3 | Type=Substitution;Start=204;End=259 |
| Q01638 | Domain | 212 | 319 | Note=Ig-like C2-type 3 | Type=Deletion;Start=260;End=556 |
| Q01638 | Domain | 375 | 535 | Note=TIR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00204 | Type=Deletion;Start=329;End=556 |
| Q01638 | Domain | 375 | 535 | Note=TIR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00204 | Type=Deletion;Start=260;End=556 |
| Q01638 | Domain | 375 | 535 | Note=TIR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00204 | Type=Deletion;Start=329;End=556 |
| Q01638 | Region | 198 | 211 | Note=Flexible linker | Type=Substitution;Start=204;End=259 |
Gene Isoform Structures and Expression Levels for IL1RL1 |
| Gene structures of our canonical and alternative spliced genes of IL1RL1 * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Expression levels of gene isoforms across GTEx. |
 |
| Expression levels of gene isoforms across TCGA. |
 |
Protein Structures |
| PDB and CIF files of the predicted protein structures * Here we show the 3D structure of the proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| 3D view using mol* of Q01638-1 |
| 3D view using mol* of Q01638-2 |
| 3D view using mol* of Q01638-3 |
| 3D view using mol* of Q01638-4 |
pLDDT Score Distribution |
| pLDDT score distribution of the predicted protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
| pLDDT distribution across the protein length of Q01638-1 |
 |
| pLDDT distribution across the protein length of Q01638-2 |
 |
| pLDDT distribution across the protein length of Q01638-3 |
 |
| pLDDT distribution across the protein length of Q01638-4 |
 |
Ramachandran Plot of Protein Structures |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this protein peptide. |
| Ramachandran plot of Q01638-1 |
 |
| Ramachandran plot of Q01638-2 |
 |
Potential Active Site Information |
| The potential binding sites of these proteins were identified using SiteMap, a module of the Schrodinger suite. |
| UniProt-id | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| Q01638-1 | 1.028 | 165 | 0.996 | 353.976 | 0.513 | 0.74 | 0.994 | 0.422 | 1.19 | 0.354 | 1.274 | 24,25,26,27,30,31,32,33,107,108,110,111,112,113,11 4,117,119,135,138,139,148,149,150,151,178,180,182, 194,195,196,197 |
| Q01638-2 | 0.998 | 111 | 0.975 | 255.535 | 0.539 | 0.694 | 0.907 | 0.556 | 1.171 | 0.475 | 1.195 | 25,27,30,105,106,107,108,109,110,111,112,113,114,1 17,148,149,150,151,178,179,180,182,195,196,197 |
| Q01638-3 | 1.024 | 243 | 1.083 | 736.078 | 0.593 | 0.656 | 0.854 | 0.83 | 0.769 | 1.079 | 0.768 | 125,126,127,170,171,172,173,202,203,204,205,206,20 7,209,210,212,213,216,217,219,220,221,223,224,227, 228,231,233,234,235,236,237,238,239,240,241,242,24 4,245,246,248,249,252 |
| Q01638-4 | 0.635 | 30 | 0.557 | 82.32 | 0.647 | 0.649 | 0.883 | 0.234 | 1.066 | 0.22 | 0.551 | 8,9,53,54,55,56,57,85,86,87,88
|
Protein Structure and Feature Comparision |
| Protein Structure Comparision Using Template Modeling Scores (TM-score). |
 |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Canonical validated structure (PDB)(green) |
| 3D view using mol* of Q01638-1_Q01638-1_4kc3_B.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical validated structure (PDB)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q01638-1_4kc3_B_Q01638-2.pdb |
| 3D view using mol* of Q01638-1_4kc3_B_Q01638-3.pdb |
| 3D view using mol* of Q01638-1_4kc3_B_Q01638-4.pdb |
| Protein Structure Comparision Visualization with mol*. between Canonical predicted structure (AF2)(orange) vs Alternative predicted structure (AF2)(green) |
| 3D view using mol* of Q01638-1_Q01638-2.pdb |
| 3D view using mol* of Q01638-1_Q01638-3.pdb |
| 3D view using mol* of Q01638-1_Q01638-4.pdb |
| Protein Feature Comparison of the protein sequendary structures among the protiens. |
| ./stats/secondary_structure/figure/Q01638-1_vs_Q01638-2.png |
 < |
| ./stats/secondary_structure/figure/Q01638-1_vs_Q01638-3.png |
 < |
| ./stats/secondary_structure/figure/Q01638-1_vs_Q01638-4.png |
 < |
| Protein Feature Comparison of the relative accessible surface area (ASA) among the protiens. |
| ./stats/relative_asa/Q01638-1_vs_Q01638-2.png |
 < |
| ./stats/relative_asa/Q01638-1_vs_Q01638-3.png |
 < |
| ./stats/relative_asa/Q01638-1_vs_Q01638-4.png |
 < |
Protein-Protein Interaction |
| Interactors from UniProt. |
| Accession_id | Subsection | Start | End | Funcitonal feature | Splicing information |
| Interactors from STRING. |
| Gene name | Interactors |
Related Drugs to IL1RL1 |
| Drugs targeting this gene/protein. (DrugBank) |
| UniProt accession | Gene name | DrugBank ID | Drug name | Drug group | Actions |
Related Diseases to IL1RL1 |
| Previous studies relating to the alternative splicing of IL1RL1 and disease information from the MeSH term (PubMed) |
| Gene | PMID | Title | Abstract | MeSH ID | MeSH term |
| IL1RL1 | 16118232 | Functional SNPs in the distal promoter of the ST2 gene are associated with atopic dermatitis. | Atopic dermatitis (AD) is a common inflammatory skin disease associated with the local infiltration of T helper type 2 (Th2) cells. The ST2 gene encodes both membrane-bound ST2L and soluble ST2 (sST2) proteins by alternative splicing. The orphan receptor ST2L is functionally indispensable for Th2 cells. We found a significant genetic association between AD and the -26999G/A single nucleotide polymorphism (SNP) (chi2-test, raw P-value=0.000007, odds ratio 1.86) in the distal promoter region of the ST2 gene (chromosome 2q12) in a study of 452 AD patients and 636 healthy controls. The -26999A allele common among AD patients positively regulates the transcriptional activity of the ST2 gene. In addition, having at least one -26999A allele correlated with high sST2 concentrations and high total IgE levels in the sera from AD patients. Thus, the -26999A allele is correlated with an increased risk for AD. We also found that the -26999G/A SNP predominantly affected the transcriptional activity of hematopoietic cells. Immunohistochemical staining of a skin biopsy specimen from an AD patient in the acute stage showed ST2 staining in the keratinocytes as well as in the infiltrating cells in the dermal layer. Our data show that functional SNPs in the ST2 distal promoter region regulate ST2 expression which induces preferential activation of the Th2 response. Our findings will contribute to the evaluation of one of the genetic risk factors for AD. | D003876 | Dermatitis, Atopic |
| IL1RL1 | 24564816 | The variations in the IL1RL1 gene and susceptibility to preeclampsia. | The IL1RL1, which encodes at least three isoforms by alternative splicing, has been identified to be involved in the initiation and perpetuation of inflammation. In spite of being a main contributor of maternal and perinatal mortality, the mechanism responsible for the pathophysiology of preeclampsia has not yet been well addressed. To investigate the relationship between IL1RL1 polymorphisms and preeclampsia risk, we identified the correlation between three tag SNPs (rs13017455, rs1420103 and rs17027006) in IL1RL1 with preeclampsia risk in a case-control study. A total of 214 cases and 208 controls were recruited to participate in this study. Genotypes of the three SNPs were determined with the use of polymerase chain reaction-restriction fragment length polymorphism assay. Significantly reduced preeclampsia risk was found to be associated with the CT genotype of rs13017455 (p = 0. 032, OR = 0. 66, 95% CI = 0.45-0.97) in overdominant model. Differences were particularly significant in the severe preeclampsia subgroup (p = 0.045, OR = 0.66, 95% CI = 0.44-0.99) and the early-onset severe preeclampsia subgroup (p = 0.0097, OR = 0.47, 95% CI = 0.26-0.84). Significantly increased mild preeclampsia risk was observed associated with GG genotype of rs1420103 polymorphisms (p = 0.029, OR = 2.18, 95% CI = 1.09-4.34), while reducing late-onset severe preeclampsia susceptibility was associated with TT genotype of rs1420103 (p = 0.02, OR = 0.49, 95% CI = 0.26-0.92). | D020022 | Genetic Predisposition to Disease |
| IL1RL1 | 24564816 | The variations in the IL1RL1 gene and susceptibility to preeclampsia. | The IL1RL1, which encodes at least three isoforms by alternative splicing, has been identified to be involved in the initiation and perpetuation of inflammation. In spite of being a main contributor of maternal and perinatal mortality, the mechanism responsible for the pathophysiology of preeclampsia has not yet been well addressed. To investigate the relationship between IL1RL1 polymorphisms and preeclampsia risk, we identified the correlation between three tag SNPs (rs13017455, rs1420103 and rs17027006) in IL1RL1 with preeclampsia risk in a case-control study. A total of 214 cases and 208 controls were recruited to participate in this study. Genotypes of the three SNPs were determined with the use of polymerase chain reaction-restriction fragment length polymorphism assay. Significantly reduced preeclampsia risk was found to be associated with the CT genotype of rs13017455 (p = 0. 032, OR = 0. 66, 95% CI = 0.45-0.97) in overdominant model. Differences were particularly significant in the severe preeclampsia subgroup (p = 0.045, OR = 0.66, 95% CI = 0.44-0.99) and the early-onset severe preeclampsia subgroup (p = 0.0097, OR = 0.47, 95% CI = 0.26-0.84). Significantly increased mild preeclampsia risk was observed associated with GG genotype of rs1420103 polymorphisms (p = 0.029, OR = 2.18, 95% CI = 1.09-4.34), while reducing late-onset severe preeclampsia susceptibility was associated with TT genotype of rs1420103 (p = 0.02, OR = 0.49, 95% CI = 0.26-0.92). | D011225 | Pre-Eclampsia |
Clinically important variants in IL1RL1 |
| (ClinVar, 04/20/2024) |
| accession_id | uniprot_id | gene_name | Type | Variant | Clinical_significance |
Copyright 2024-PresentThe University of Texas Health Science Center at Houston (UTHealth Houston) Web File Viewing | Emergency Information |